PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00028.1_g00049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 318aa    MW: 36561.6 Da    PI: 5.2236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00028.1_g00049.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-182774148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd +l++++  +G g+W++ +r+ g++Rt+k+c++rw++yl
  Rsa1.0_00028.1_g00049.1 27 RGPWTVEEDFKLINYISTHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 74
                             89********************************************97 PP

2Myb_DNA-binding50.54.7e-1680123146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Rsa1.0_00028.1_g00049.1  80 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 123
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0552274IPR017930Myb domain
SuperFamilySSF466898.61E-3125121IPR009057Homeodomain-like
SMARTSM007172.0E-152676IPR001005SANT/Myb domain
PfamPF002493.6E-162774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-222881IPR009057Homeodomain-like
CDDcd001678.67E-122974No hitNo description
PROSITE profilePS5129422.91775129IPR017930Myb domain
SMARTSM007172.9E-1479127IPR001005SANT/Myb domain
PfamPF002497.8E-1580123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2282128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDDKRSLMMN KNIGDFENKD EEMDPRRGPW TVEEDFKLIN YISTHGEGRW NSLSRCAGLK  60
RTGKSCRLRW LNYLRPDVRR GNITLEEQLL ILELHSRWGN RWSKIAQYLP GRTDNEIKNY  120
WRTRVQKHAK QLRCDVNSQQ FKDTMRYLWM PRLIERIQAS ASTSTGSATT SSCVTTPSDQ  180
FLMTSFDDGL NNNNNNMDHL SFMSNPNGYV SPETSSVVVS PTSGLTEFHI GSEVGKVENN  240
QDQSLVGPQI MSPPPQNYLD DNGGLLSEDL TQSYHNWFEN VNGMIPPYSD SFWNIGSDED  300
FWLLLQQQQQ LVNNGSSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-252712127120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756560.0KM975656.1 Brassica napus MYB transcription factor 78-1.1 (MYB78-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675280.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-112MY108_ARATH; Transcription factor MYB108
TrEMBLA0A078EWL80.0A0A078EWL8_BRANA; BnaC02g39260D protein
STRINGBra020624.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-125myb domain protein 78